PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0253s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 246aa    MW: 27430.7 Da    PI: 8.4465
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0253s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.8e-3246103159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +dDgynWrKYGqK+vkgse+prsYY+Ct   Cpv+kkvers  +++++ei+Y+g+Hnhe
  Kalax.0253s0030.1.p  46 VDDGYNWRKYGQKQVKGSEYPRSYYKCTCFCCPVRKKVERSP-EGQIIEIIYKGQHNHE 103
                          59****************************************.***************8 PP

2WRKY37.16.3e-12220244127
                          ---SS-EEEEEEE--TT-SS-EEEEEE CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrC 27 
                          ldDg++WrKYGqK vkg+ +pr  YrC
  Kalax.0253s0030.1.p 220 LDDGFRWRKYGQKAVKGNSHPR--YRC 244
                          59********************..898 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-2839104IPR003657WRKY domain
PROSITE profilePS5081122.99741105IPR003657WRKY domain
SuperFamilySSF1182903.92E-2543104IPR003657WRKY domain
SMARTSM007748.5E-3346104IPR003657WRKY domain
PfamPF031061.3E-2447103IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.0E-13206244IPR003657WRKY domain
SuperFamilySSF1182903.14E-10212244IPR003657WRKY domain
PROSITE profilePS5081114.47215245IPR003657WRKY domain
SMARTSM007740.001220245IPR003657WRKY domain
PfamPF031069.7E-8221244IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MQNQAGTGSY KPPSTLEPEI ASIAPSEVFH AGPKSQPPTA ASDKPVDDGY NWRKYGQKQV  60
KGSEYPRSYY KCTCFCCPVR KKVERSPEGQ IIEIIYKGQH NHEQSPPKKS AKDGNDPIEN  120
VISQAMPDDN QLDRAEVPKR PTEAPPEQIV HEKDEKFLQE TSVDSRPLST DETRGNADSE  180
NGPMLKKRNS GSAVGEPNLP QKTVVEPKIV VRTRSEVDLL DDGFRWRKYG QKAVKGNSHP  240
RYRCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-17461061475WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089564.15e-72putative WRKY transcription factor 3
SwissprotQ9ZQ702e-57WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLW9QTC55e-72W9QTC5_9R
STRINGVIT_14s0108g01280.t015e-69(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-58WRKY DNA-binding protein 3